SCOPe 2.08: Domain d2uzxc2: 2uzx C:241-320

Lineage for d2uzxc2 (2uzx C:241-320)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [225327] (8 PDB entries)

8. Domain d2uzxc2: 2uzx C:241-320 [206195]
   Other proteins in same PDB: d2uzxa1, d2uzxa3, d2uzxc1, d2uzxc3
   automated match to d1m9sa1

Details for d2uzxc2

PDB Entry: 2uzx, 2.8 Å

PDB Description: structure of the human receptor tyrosine kinase met in complex with the listeria monocytogenes invasion protein inlb: crystal form i

PDB Compounds: (C:) internalin b

SCOPe Domain Sequences for d2uzxc2:

Sequence; same for both SEQRES and ATOM records:

>d2uzxc2 b.1.18.0 (C:241-320) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplk

Timeline for d2uzxc2:

• d2uzxc2 first appeared in SCOPe 2.03
  
• d2uzxc2 appears in SCOPe 2.07