| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Listeria monocytogenes [TaxId:169963] [225327] (8 PDB entries) |
| Domain d2uzxc2: 2uzx C:241-320 [206195] Other proteins in same PDB: d2uzxa1, d2uzxa3, d2uzxc1, d2uzxc3 automated match to d1m9sa1 |
PDB Entry: 2uzx (more details), 2.8 Å
SCOPe Domain Sequences for d2uzxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uzxc2 b.1.18.0 (C:241-320) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplk
Timeline for d2uzxc2: