Lineage for d2uzxa1 (2uzx A:34-240)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583821Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1583886Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1583887Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
    capped at the N-end with a truncated EF-hand subdomain
    this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
  6. 1583912Protein automated matches [226952] (1 species)
    not a true protein
  7. 1583913Species Listeria monocytogenes [TaxId:169963] [225326] (5 PDB entries)
  8. 1583926Domain d2uzxa1: 2uzx A:34-240 [206192]
    Other proteins in same PDB: d2uzxa2, d2uzxc2
    automated match to d1m9sa5

Details for d2uzxa1

PDB Entry: 2uzx (more details), 2.8 Å

PDB Description: structure of the human receptor tyrosine kinase met in complex with the listeria monocytogenes invasion protein inlb: crystal form i
PDB Compounds: (A:) internalin b

SCOPe Domain Sequences for d2uzxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzxa1 c.10.2.1 (A:34-240) automated matches {Listeria monocytogenes [TaxId: 169963]}
ametitvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqg
iqylpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehng
isdinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnl
ylsknhisdlralaglknldvlelfsq

SCOPe Domain Coordinates for d2uzxa1:

Click to download the PDB-style file with coordinates for d2uzxa1.
(The format of our PDB-style files is described here.)

Timeline for d2uzxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2uzxa2