Lineage for d1d9ke_ (1d9k E:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 220318Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 220353Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (14 PDB entries)
  8. 220375Domain d1d9ke_: 1d9k E: [20619]
    Other proteins in same PDB: d1d9kc1, d1d9kc2, d1d9kd1, d1d9kd2, d1d9kg1, d1d9kg2, d1d9kh1, d1d9kh2

Details for d1d9ke_

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca

SCOP Domain Sequences for d1d9ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9ke_ b.1.1.1 (E:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qvrqspqsltvwegettilncsyedstfdyfpwyrqfpgkspalliaislvsnkkedgrf
tiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfgagtrlavspy

SCOP Domain Coordinates for d1d9ke_:

Click to download the PDB-style file with coordinates for d1d9ke_.
(The format of our PDB-style files is described here.)

Timeline for d1d9ke_: