SCOPe 2.05: Domain d2uxsa_: 2uxs A:

Lineage for d2uxsa_ (2uxs A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.0: automated matches [191399] (1 protein)
   not a true family

6. Protein automated matches [190523] (11 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225097] (6 PDB entries)

8. Domain d2uxsa_: 2uxs A: [206184]
   automated match to d3tr4b_
   complexed with po4

Details for d2uxsa_

PDB Entry: 2uxs, 2.7 Å

PDB Description: 2.7a crystal structure of inorganic pyrophosphatase (rv3628) from mycobacterium tuberculosis at ph 7.5

PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d2uxsa_:

Sequence; same for both SEQRES and ATOM records:

>d2uxsa_ b.40.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gvqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldal
vllpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldai
khffvhykdlepgkfvkaadwvdraeaeaevqrsverfka

Timeline for d2uxsa_:

• d2uxsa_ first appeared in SCOPe 2.03
  
• d2uxsa_ appears in SCOPe 2.04
  
• d2uxsa_ is called d2uxsa1 in SCOPe 2.06
  
• d2uxsa_ appears in the current release, SCOPe 2.08, called d2uxsa1