SCOPe 2.08: Domain d2uxsa1: 2uxs A:8-166

Lineage for d2uxsa1 (2uxs A:8-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.0: automated matches [191399] (1 protein)
   not a true family

6. Protein automated matches [190523] (12 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225097] (8 PDB entries)

8. Domain d2uxsa1: 2uxs A:8-166 [206184]
   Other proteins in same PDB: d2uxsa2, d2uxsb2, d2uxsc2
   automated match to d3tr4b_
   complexed with po4

Details for d2uxsa1

PDB Entry: 2uxs, 2.7 Å

PDB Description: 2.7a crystal structure of inorganic pyrophosphatase (rv3628) from mycobacterium tuberculosis at ph 7.5

PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d2uxsa1:

Sequence; same for both SEQRES and ATOM records:

>d2uxsa1 b.40.5.0 (A:8-166) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
vqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldalv
llpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldaik
hffvhykdlepgkfvkaadwvdraeaeaevqrsverfka

Timeline for d2uxsa1:

• d2uxsa1 first appeared in SCOPe 2.03, called d2uxsa_
  
• d2uxsa1 appears in SCOPe 2.07