Lineage for d1d9ka_ (1d9k A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 103212Protein T-cell antigen receptor [48933] (6 species)
  7. 103239Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (12 PDB entries)
  8. 103256Domain d1d9ka_: 1d9k A: [20618]
    Other proteins in same PDB: d1d9kc1, d1d9kc2, d1d9kd1, d1d9kd2, d1d9kg1, d1d9kg2, d1d9kh1, d1d9kh2

Details for d1d9ka_

PDB Entry: 1d9k (more details), 3.2 Å

PDB Description: crystal structure of complex between d10 tcr and pmhc i-ak/ca

SCOP Domain Sequences for d1d9ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9ka_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qvrqspqsltvwegettilncsyedstfdyfpwyrqfpgkspalliaislvsnkkedgrf
tiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfgagtrlavspy

SCOP Domain Coordinates for d1d9ka_:

Click to download the PDB-style file with coordinates for d1d9ka_.
(The format of our PDB-style files is described here.)

Timeline for d1d9ka_: