Lineage for d2uvoe1 (2uvo E:1-52)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3029894Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 3029895Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 3029942Protein Wheat germ agglutinin (WGA) [57018] (1 species)
    one subunit consists of four homologous domains
  7. 3029943Species Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId:4565] [57019] (13 PDB entries)
  8. 3029952Domain d2uvoe1: 2uvo E:1-52 [206176]
    automated match to d2cwga1
    complexed with gol, nag, ndg

Details for d2uvoe1

PDB Entry: 2uvo (more details), 1.4 Å

PDB Description: high resolution crystal structure of wheat germ agglutinin in complex with n-acetyl-d-glucosamine
PDB Compounds: (E:) agglutinin isolectin 1

SCOPe Domain Sequences for d2uvoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uvoe1 g.3.1.1 (E:1-52) Wheat germ agglutinin (WGA) {Wheat (Triticum aestivum), also known as Triticum vulgare [TaxId: 4565]}
ercgeqgsnmecpnnlccsqygycgmggdycgkgcqngacwtskrcgsqagg

SCOPe Domain Coordinates for d2uvoe1:

Click to download the PDB-style file with coordinates for d2uvoe1.
(The format of our PDB-style files is described here.)

Timeline for d2uvoe1: