Lineage for d1g6rc1 (1g6r C:1-117)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 8110Protein T-cell antigen receptor [48933] (5 species)
  7. 8128Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (10 PDB entries)
  8. 8141Domain d1g6rc1: 1g6r C:1-117 [20617]
    Other proteins in same PDB: d1g6ra2, d1g6rb2, d1g6rc2, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl1, d1g6rm1

Details for d1g6rc1

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

SCOP Domain Sequences for d1g6rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6rc1 b.1.1.1 (C:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

SCOP Domain Coordinates for d1g6rc1:

Click to download the PDB-style file with coordinates for d1g6rc1.
(The format of our PDB-style files is described here.)

Timeline for d1g6rc1: