Lineage for d2uv3b_ (2uv3 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296101Domain d2uv3b_: 2uv3 B: [206165]
    automated match to d2i26o_
    complexed with mes, so4

Details for d2uv3b_

PDB Entry: 2uv3 (more details), 1.8 Å

PDB Description: structure of the signal-regulatory protein (sirp) alpha domain that binds cd47.
PDB Compounds: (B:) tyrosine-protein phosphatase non-receptor type substrate 1

SCOPe Domain Sequences for d2uv3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uv3b_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprvt
tvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvrakpstrh
hh

SCOPe Domain Coordinates for d2uv3b_:

Click to download the PDB-style file with coordinates for d2uv3b_.
(The format of our PDB-style files is described here.)

Timeline for d2uv3b_: