SCOPe 2.08: Domain d2uv3a1: 2uv3 A:2-119

Lineage for d2uv3a1 (2uv3 A:2-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d2uv3a1: 2uv3 A:2-119 [206164]
   Other proteins in same PDB: d2uv3a2, d2uv3b2
   automated match to d2i26o_
   complexed with mes, so4

Details for d2uv3a1

PDB Entry: 2uv3, 1.8 Å

PDB Description: structure of the signal-regulatory protein (sirp) alpha domain that binds cd47.

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type substrate 1

SCOPe Domain Sequences for d2uv3a1:

Sequence; same for both SEQRES and ATOM records:

>d2uv3a1 b.1.1.0 (A:2-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eelqviqpdksvsvaagesailhctvtslipvgpiqwfrgagpareliynqkeghfprvt
tvsestkrenmdfsisisnitpadagtyycvkfrkgspdtefksgagtelsvrakpst

Timeline for d2uv3a1:

• d2uv3a1 first appeared in SCOPe 2.03, called d2uv3a_
  
• d2uv3a1 appears in SCOPe 2.07