Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (16 PDB entries) |
Domain d1g6ra1: 1g6r A:1-117 [20616] Other proteins in same PDB: d1g6ra2, d1g6rb2, d1g6rc2, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl_, d1g6rm_ |
PDB Entry: 1g6r (more details), 2.8 Å
SCOP Domain Sequences for d1g6ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6ra1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain} qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy
Timeline for d1g6ra1: