Lineage for d1g6ra1 (1g6r A:1-117)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 158716Protein T-cell antigen receptor [48933] (6 species)
  7. 158747Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (14 PDB entries)
  8. 158770Domain d1g6ra1: 1g6r A:1-117 [20616]
    Other proteins in same PDB: d1g6ra2, d1g6rb2, d1g6rc2, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl1, d1g6rm1

Details for d1g6ra1

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

SCOP Domain Sequences for d1g6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6ra1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

SCOP Domain Coordinates for d1g6ra1:

Click to download the PDB-style file with coordinates for d1g6ra1.
(The format of our PDB-style files is described here.)

Timeline for d1g6ra1: