![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins) |
![]() | Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69615] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [225315] (42 PDB entries) |
![]() | Domain d2rk8b1: 2rk8 B:4-259 [206153] Other proteins in same PDB: d2rk8a2, d2rk8b2 automated match to d1khba2 complexed with fmt, mn, na, peg, ppf |
PDB Entry: 2rk8 (more details), 2 Å
SCOPe Domain Sequences for d2rk8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rk8b1 c.109.1.1 (B:4-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]} qlhngldfsakviqgsldslpqevrkfvegnaqlcqpeyihicdgseeeygrllahmqee gvirklkkydncwlaltdprdvariesktviitqeqrdtvpipksgqsqlgrwmseedfe kafnarfpgcmkgrtmyvipfsmgplgsplakigieltdspyvvasmrimtrmgtsvlea lgdgefikclhsvgcplplkkplvnnwacnpeltliahlpdrreiisfgsgyggnsllgk kcfalriasrlakeeg
Timeline for d2rk8b1: