Lineage for d2rk7b2 (2rk7 B:260-622)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143073Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 protein domains)
  6. 2143074Protein Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) [69612] (2 species)
  7. 2143084Species Norway rat (Rattus norvegicus) [TaxId:10116] [225316] (40 PDB entries)
  8. 2143116Domain d2rk7b2: 2rk7 B:260-622 [206150]
    Other proteins in same PDB: d2rk7a1, d2rk7b1
    automated match to d1khba1
    complexed with mn, na, oxl

Details for d2rk7b2

PDB Entry: 2rk7 (more details), 1.9 Å

PDB Description: the structure of rat cytosolic pepck in complex with oxalate
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase, cytosolic [GTP]

SCOPe Domain Sequences for d2rk7b2:

Sequence, based on SEQRES records: (download)

>d2rk7b2 c.91.1.1 (B:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wlaehmlilgitnpegkkkylaaafpsacgktnlammnptlpgwkvecvgddiawmkfda
qgnlrainpengffgvapgtsvktnpnaiktiqkntiftnvaetsdggvywegideplap
gvtitswknkewrpqdeepcahpnsrfctpasqcpiidpawespegvpiegiifggrrpa
gvplvyealswqhgvfvgaamrseataaaehkgkvimhdpfamrpffgynfgkylahwls
mahrpaaklpkifhvnwfrkdkngkflwpgfgensrvlewmfgriegedsakltpigyvp
kedalnlkglgdvnveelfgiskefwekeveeidkyledqvnadlpyeierelralkqri
sqm

Sequence, based on observed residues (ATOM records): (download)

>d2rk7b2 c.91.1.1 (B:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
wlaehmlilgitnpegkkkylaaafpsacgktnlammnptlpgwkvecvgddiawmkfda
qgnlrainpengffgvapgtsvktnpnaiktiqkntiftnvaetsdggvywegideplap
gvtitswknkewrpqdeepcahpnsrfctpasqcpiidpawespegvpiegiifggrrpa
gvplvyealswqhgvfvgaamrseatgkvimhdpfamrpffgynfgkylahwlsmahrpa
aklpkifhvnwfrkdkngkflwpgfgensrvlewmfgriegedsakltpigyvpkedaln
lkglgdvnveelfgiskefwekeveeidkyledqvnadlpyeierelralkqrisqm

SCOPe Domain Coordinates for d2rk7b2:

Click to download the PDB-style file with coordinates for d2rk7b2.
(The format of our PDB-style files is described here.)

Timeline for d2rk7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rk7b1