Lineage for d2ckbc1 (2ckb C:1-117)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023718Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 2023823Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries)
  8. 2023853Domain d2ckbc1: 2ckb C:1-117 [20615]
    Other proteins in same PDB: d2ckba2, d2ckbb2, d2ckbc2, d2ckbd2, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl_, d2ckbm_

Details for d2ckbc1

PDB Entry: 2ckb (more details), 3 Å

PDB Description: structure of the 2c/kb/dev8 complex
PDB Compounds: (C:) alpha, beta t cell receptor

SCOPe Domain Sequences for d2ckbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbc1 b.1.1.1 (C:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

SCOPe Domain Coordinates for d2ckbc1:

Click to download the PDB-style file with coordinates for d2ckbc1.
(The format of our PDB-style files is described here.)

Timeline for d2ckbc1: