Lineage for d2ckbc1 (2ckb C:1-117)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 8110Protein T-cell antigen receptor [48933] (5 species)
  7. 8128Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (10 PDB entries)
  8. 8139Domain d2ckbc1: 2ckb C:1-117 [20615]
    Other proteins in same PDB: d2ckba2, d2ckbb2, d2ckbc2, d2ckbd2, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl1, d2ckbm1

Details for d2ckbc1

PDB Entry: 2ckb (more details), 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex
PDB Compounds: (C:)

SCOP Domain Sequences for d2ckbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbc1 b.1.1.1 (C:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

SCOP Domain Coordinates for d2ckbc1:

Click to download the PDB-style file with coordinates for d2ckbc1.
(The format of our PDB-style files is described here.)

Timeline for d2ckbc1: