Lineage for d2rjtd2 (2rjt D:252-409)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916662Protein Beta-ketoacyl-ACP synthase II, C-terminal domain [419017] (6 species)
  7. 2916668Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [419491] (4 PDB entries)
  8. 2916673Domain d2rjtd2: 2rjt D:252-409 [206146]
    Other proteins in same PDB: d2rjta1, d2rjtb1, d2rjtc1, d2rjtd1
    automated match to d1ox0a2
    mutant

Details for d2rjtd2

PDB Entry: 2rjt (more details), 1.75 Å

PDB Description: crystal structure analysis of a surface entropy reduction mutant of s. pneumoniae fabf
PDB Compounds: (D:) Beta-ketoacyl-ACP synthase II

SCOPe Domain Sequences for d2rjtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjtd2 c.95.1.1 (D:252-409) Beta-ketoacyl-ACP synthase II, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvnahgtstpane
kgesgaivavlgkavpvsstksftghllgaagaveaivtieamrhnfvpmtagtsevsdy
ieanvvygqglakeipyaisntfgfgghnavlafkrwa

SCOPe Domain Coordinates for d2rjtd2:

Click to download the PDB-style file with coordinates for d2rjtd2.
(The format of our PDB-style files is described here.)

Timeline for d2rjtd2: