| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
| Protein Beta-ketoacyl-ACP synthase II, C-terminal domain [419017] (6 species) |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [419491] (4 PDB entries) |
| Domain d2rjtd2: 2rjt D:252-409 [206146] Other proteins in same PDB: d2rjta1, d2rjtb1, d2rjtc1, d2rjtd1 automated match to d1ox0a2 mutant |
PDB Entry: 2rjt (more details), 1.75 Å
SCOPe Domain Sequences for d2rjtd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rjtd2 c.95.1.1 (D:252-409) Beta-ketoacyl-ACP synthase II, C-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tilaevvgygntcdayhmtsphpegqgaikaiklaleeaeispeqvayvnahgtstpane
kgesgaivavlgkavpvsstksftghllgaagaveaivtieamrhnfvpmtagtsevsdy
ieanvvygqglakeipyaisntfgfgghnavlafkrwa
Timeline for d2rjtd2: