SCOPe 2.08: Domain d2rjtb1: 2rjt B:2-251

Lineage for d2rjtb1 (2rjt B:2-251)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase II, N-terminal domain [419016] (6 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [419490] (4 PDB entries)

8. Domain d2rjtb1: 2rjt B:2-251 [206141]
   Other proteins in same PDB: d2rjta2, d2rjtb2, d2rjtc2, d2rjtd2
   automated match to d1ox0a1
   mutant
   has additional insertions and/or extensions that are not grouped together

Details for d2rjtb1

PDB Entry: 2rjt, 1.75 Å

PDB Description: crystal structure analysis of a surface entropy reduction mutant of s. pneumoniae fabf

PDB Compounds: (B:) Beta-ketoacyl-ACP synthase II

SCOPe Domain Sequences for d2rjtb1:

Sequence; same for both SEQRES and ATOM records:

>d2rjtb1 c.95.1.1 (B:2-251) Beta-ketoacyl-ACP synthase II, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
klnrvvvtgygvtspigntpaefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
yfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrfgvivasgiggikeiedqvlr
lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
slehaekrga

Timeline for d2rjtb1:

• d2rjtb1 first appeared in SCOPe 2.03
  
• d2rjtb1 appears in SCOPe 2.07