![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein Beta-ketoacyl-ACP synthase II, N-terminal domain [419016] (6 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [419490] (4 PDB entries) |
![]() | Domain d2rjtb1: 2rjt B:2-251 [206141] Other proteins in same PDB: d2rjta2, d2rjtb2, d2rjtc2, d2rjtd2 automated match to d1ox0a1 mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2rjt (more details), 1.75 Å
SCOPe Domain Sequences for d2rjtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rjtb1 c.95.1.1 (B:2-251) Beta-ketoacyl-ACP synthase II, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} klnrvvvtgygvtspigntpaefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk yfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrfgvivasgiggikeiedqvlr lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle slehaekrga
Timeline for d2rjtb1: