Lineage for d2ckba1 (2ckb A:1-117)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 158716Protein T-cell antigen receptor [48933] (6 species)
  7. 158747Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (14 PDB entries)
  8. 158766Domain d2ckba1: 2ckb A:1-117 [20614]
    Other proteins in same PDB: d2ckba2, d2ckbb2, d2ckbc2, d2ckbd2, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl1, d2ckbm1

Details for d2ckba1

PDB Entry: 2ckb (more details), 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckba1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

SCOP Domain Coordinates for d2ckba1:

Click to download the PDB-style file with coordinates for d2ckba1.
(The format of our PDB-style files is described here.)

Timeline for d2ckba1: