SCOP 1.59: Domain d2ckba1: 2ckb A:1-117

Lineage for d2ckba1 (2ckb A:1-117)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (12 PDB entries)

8. Domain d2ckba1: 2ckb A:1-117 [20614]
   Other proteins in same PDB: d2ckba2, d2ckbb2, d2ckbc2, d2ckbd2, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl1, d2ckbm1

Details for d2ckba1

PDB Entry: 2ckb, 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckba1:

Sequence; same for both SEQRES and ATOM records:

>d2ckba1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpy

Timeline for d2ckba1:

• d2ckba1 first appeared (with stable ids) in SCOP 1.55
  
• d2ckba1 appears in SCOP 1.57
  
• d2ckba1 appears in SCOP 1.61
  
• d2ckba1 appears in the current release, SCOPe 2.08