Lineage for d2rjta1 (2rjt A:2-251)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2164459Family c.95.1.1: Thiolase-related [53902] (10 proteins)
  6. 2164634Protein Beta-ketoacyl-ACP synthase II [53909] (6 species)
  7. 2164644Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89793] (4 PDB entries)
  8. 2164647Domain d2rjta1: 2rjt A:2-251 [206139]
    automated match to d1ox0a1
    mutant

Details for d2rjta1

PDB Entry: 2rjt (more details), 1.75 Å

PDB Description: crystal structure analysis of a surface entropy reduction mutant of s. pneumoniae fabf
PDB Compounds: (A:) Beta-ketoacyl-ACP synthase II

SCOPe Domain Sequences for d2rjta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rjta1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
klnrvvvtgygvtspigntpaefwnslatgkigiggitkfdhsdfdvhnaaeiqdfpfdk
yfvkkdtnrfdnyslyalyaaqeavnhanldvaalnrdrfgvivasgiggikeiedqvlr
lhekgpkrvkpmtlpkalpnmasgnvamrfgangvcksintacsssndaigdafrsikfg
fqdvmlvggteasitpfaiagfqaltalsttedptrasipfdkdrngfvmgegsgmlvle
slehaekrga

SCOPe Domain Coordinates for d2rjta1:

Click to download the PDB-style file with coordinates for d2rjta1.
(The format of our PDB-style files is described here.)

Timeline for d2rjta1: