Lineage for d2rhsc_ (2rhs C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1663707Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1663708Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1664082Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 1664083Protein automated matches [226887] (8 species)
    not a true protein
  7. 1664128Species Staphylococcus haemolyticus [TaxId:1283] [225371] (2 PDB entries)
  8. 1664131Domain d2rhsc_: 2rhs C: [206135]
    automated match to d1b7ya_
    complexed with gax, so4, zn

Details for d2rhsc_

PDB Entry: 2rhs (more details), 2.2 Å

PDB Description: phers from staphylococcus haemolyticus- rational protein engineering and inhibitor studies
PDB Compounds: (C:) phenylalanyl-tRNA synthetase alpha chain

SCOPe Domain Sequences for d2rhsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhsc_ d.104.1.0 (C:) automated matches {Staphylococcus haemolyticus [TaxId: 1283]}
elmeklnqqlaeetidvtlpsrqisigskhpltrtveeiedlflglgyeivdgyeveqdy
ynfealnlpkshpardmqdsfyitdeilmrthtspvqartmekrngqgpvkiicpgkvyr
rdsddathshqftqieglvvdknikmsdlkgtlelvakklfgadreirlrpsyfpfteps
vevdvscfkckgkgcnvckhtgwieilgagmvhpnvlemagfdsneysgfafgmgpdria
mlkygiediryfytndvrfleqfkavedrge

SCOPe Domain Coordinates for d2rhsc_:

Click to download the PDB-style file with coordinates for d2rhsc_.
(The format of our PDB-style files is described here.)

Timeline for d2rhsc_: