SCOPe 2.03: Domain d2rhsc_: 2rhs C:

Lineage for d2rhsc_ (2rhs C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (7 species)
   not a true protein

7. Species Staphylococcus haemolyticus [TaxId:1283] [225371] (2 PDB entries)

8. Domain d2rhsc_: 2rhs C: [206135]
   automated match to d1b7ya_
   complexed with gax, so4, zn

Details for d2rhsc_

PDB Entry: 2rhs, 2.2 Å

PDB Description: phers from staphylococcus haemolyticus- rational protein engineering and inhibitor studies

PDB Compounds: (C:) phenylalanyl-tRNA synthetase alpha chain

SCOPe Domain Sequences for d2rhsc_:

Sequence; same for both SEQRES and ATOM records:

>d2rhsc_ d.104.1.0 (C:) automated matches {Staphylococcus haemolyticus [TaxId: 1283]}
elmeklnqqlaeetidvtlpsrqisigskhpltrtveeiedlflglgyeivdgyeveqdy
ynfealnlpkshpardmqdsfyitdeilmrthtspvqartmekrngqgpvkiicpgkvyr
rdsddathshqftqieglvvdknikmsdlkgtlelvakklfgadreirlrpsyfpfteps
vevdvscfkckgkgcnvckhtgwieilgagmvhpnvlemagfdsneysgfafgmgpdria
mlkygiediryfytndvrfleqfkavedrge

Timeline for d2rhsc_:

• d2rhsc_ is new in SCOPe 2.03-stable
  
• d2rhsc_ appears in SCOPe 2.04
  
• d2rhsc_ appears in the current release, SCOPe 2.08, called d2rhsc1