SCOPe 2.08: Domain d2rhqa1: 2rhq A:84-351

Lineage for d2rhqa1 (2rhq A:84-351)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Staphylococcus haemolyticus [TaxId:1283] [225371] (2 PDB entries)

8. Domain d2rhqa1: 2rhq A:84-351 [206133]
   Other proteins in same PDB: d2rhqa2
   automated match to d1b7ya_
   complexed with gax, zn

Details for d2rhqa1

PDB Entry: 2rhq, 2.2 Å

PDB Description: phers from staphylococcus haemolyticus- rational protein engineering and inhibitor studies

PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOPe Domain Sequences for d2rhqa1:

Sequence; same for both SEQRES and ATOM records:

>d2rhqa1 d.104.1.0 (A:84-351) automated matches {Staphylococcus haemolyticus [TaxId: 1283]}
eklnqqlaeetidvtlpsrqisigskhpltrtveeiedlflglgyeivdgyeveqdyynf
ealnlpkshpardmqdsfyitdeilmrthtspvqartmekrngqgpvkiicpgkvyrrds
ddathshqftqieglvvdknikmsdlkgtlelvakklfgadreirlrpsyfpftepsvev
dvscfkckgkgcnvckhtgwieilgagmvhpnvlemagfdsneysgfafgmgpdriamlk
ygiediryfytndvrfleqfkavedrge

Timeline for d2rhqa1:

• d2rhqa1 first appeared in SCOPe 2.03, called d2rhqa_
  
• d2rhqa1 appears in SCOPe 2.07