Lineage for d2rhqa1 (2rhq A:84-351)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968201Species Staphylococcus haemolyticus [TaxId:1283] [225371] (2 PDB entries)
  8. 2968202Domain d2rhqa1: 2rhq A:84-351 [206133]
    Other proteins in same PDB: d2rhqa2
    automated match to d1b7ya_
    complexed with gax, zn

Details for d2rhqa1

PDB Entry: 2rhq (more details), 2.2 Å

PDB Description: phers from staphylococcus haemolyticus- rational protein engineering and inhibitor studies
PDB Compounds: (A:) phenylalanyl-tRNA synthetase alpha chain

SCOPe Domain Sequences for d2rhqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhqa1 d.104.1.0 (A:84-351) automated matches {Staphylococcus haemolyticus [TaxId: 1283]}
eklnqqlaeetidvtlpsrqisigskhpltrtveeiedlflglgyeivdgyeveqdyynf
ealnlpkshpardmqdsfyitdeilmrthtspvqartmekrngqgpvkiicpgkvyrrds
ddathshqftqieglvvdknikmsdlkgtlelvakklfgadreirlrpsyfpftepsvev
dvscfkckgkgcnvckhtgwieilgagmvhpnvlemagfdsneysgfafgmgpdriamlk
ygiediryfytndvrfleqfkavedrge

SCOPe Domain Coordinates for d2rhqa1:

Click to download the PDB-style file with coordinates for d2rhqa1.
(The format of our PDB-style files is described here.)

Timeline for d2rhqa1: