Lineage for d2rhob1 (2rho B:12-208)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471423Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2471428Species Bacillus subtilis [TaxId:1423] [225542] (4 PDB entries)
  8. 2471432Domain d2rhob1: 2rho B:12-208 [206131]
    Other proteins in same PDB: d2rhoa2, d2rhoa3, d2rhob2
    automated match to d1rq2a1
    complexed with gdp, gsp

Details for d2rhob1

PDB Entry: 2rho (more details), 2.45 Å

PDB Description: synthetic gene encoded bacillus subtilis ftsz ncs dimer with bound gdp and gtp-gamma-s
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d2rhob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhob1 c.32.1.1 (B:12-208) Cell-division protein FtsZ {Bacillus subtilis [TaxId: 1423]}
asikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglga
ganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgv
vtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlr
qgvqgisdliatpglin

SCOPe Domain Coordinates for d2rhob1:

Click to download the PDB-style file with coordinates for d2rhob1.
(The format of our PDB-style files is described here.)

Timeline for d2rhob1: