SCOPe 2.03: Domain d2rhoa1: 2rho A:12-208

Lineage for d2rhoa1 (2rho A:12-208)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Cell-division protein FtsZ [52492] (9 species)

7. Species Bacillus subtilis [TaxId:1423] [225542] (4 PDB entries)

8. Domain d2rhoa1: 2rho A:12-208 [206129]
   Other proteins in same PDB: d2rhoa2, d2rhob2
   automated match to d1rq2a1
   complexed with gdp, gsp

Details for d2rhoa1

PDB Entry: 2rho, 2.45 Å

PDB Description: synthetic gene encoded bacillus subtilis ftsz ncs dimer with bound gdp and gtp-gamma-s

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2rhoa1:

Sequence; same for both SEQRES and ATOM records:

>d2rhoa1 c.32.1.1 (A:12-208) Cell-division protein FtsZ {Bacillus subtilis [TaxId: 1423]}
asikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglga
ganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgv
vtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlr
qgvqgisdliatpglin

Timeline for d2rhoa1:

• d2rhoa1 is new in SCOPe 2.03-stable
  
• d2rhoa1 appears in SCOPe 2.04
  
• d2rhoa1 appears in the current release, SCOPe 2.08