![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein Cell-division protein FtsZ [52492] (9 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [225542] (4 PDB entries) |
![]() | Domain d2rhoa1: 2rho A:12-208 [206129] Other proteins in same PDB: d2rhoa2, d2rhoa3, d2rhob2 automated match to d1rq2a1 complexed with gdp, gsp |
PDB Entry: 2rho (more details), 2.45 Å
SCOPe Domain Sequences for d2rhoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhoa1 c.32.1.1 (A:12-208) Cell-division protein FtsZ {Bacillus subtilis [TaxId: 1423]} asikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglga ganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgv vtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlr qgvqgisdliatpglin
Timeline for d2rhoa1: