SCOPe 2.05: Domain d2rhlb2: 2rhl B:209-326

Lineage for d2rhlb2 (2rhl B:209-326)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Cell-division protein FtsZ [55309] (9 species)

7. Species Bacillus subtilis [TaxId:1423] [225543] (4 PDB entries)

8. Domain d2rhlb2: 2rhl B:209-326 [206128]
   Other proteins in same PDB: d2rhla1, d2rhlb1
   automated match to d1rq2a2
   complexed with gdp

Details for d2rhlb2

PDB Entry: 2rhl, 2.45 Å

PDB Description: synthetic gene encoded bacillus subtilis ftsz ncs dimer with bound gdp

PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d2rhlb2:

Sequence; same for both SEQRES and ATOM records:

>d2rhlb2 d.79.2.1 (B:209-326) Cell-division protein FtsZ {Bacillus subtilis [TaxId: 1423]}
ldfadvktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggt
nlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtviatgflenlyfqghhh

Timeline for d2rhlb2:

• d2rhlb2 first appeared in SCOPe 2.03
  
• d2rhlb2 appears in SCOPe 2.04
  
• d2rhlb2 appears in SCOPe 2.06
  
• d2rhlb2 appears in the current release, SCOPe 2.08