Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Cell-division protein FtsZ [55309] (9 species) |
Species Bacillus subtilis [TaxId:1423] [225543] (4 PDB entries) |
Domain d2rhlb2: 2rhl B:209-326 [206128] Other proteins in same PDB: d2rhla1, d2rhlb1 automated match to d1rq2a2 complexed with gdp |
PDB Entry: 2rhl (more details), 2.45 Å
SCOPe Domain Sequences for d2rhlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhlb2 d.79.2.1 (B:209-326) Cell-division protein FtsZ {Bacillus subtilis [TaxId: 1423]} ldfadvktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggt nlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtviatgflenlyfqghhh
Timeline for d2rhlb2: