Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein Cell-division protein FtsZ [52492] (9 species) |
Species Bacillus subtilis [TaxId:1423] [225542] (4 PDB entries) |
Domain d2rhlb1: 2rhl B:12-208 [206127] Other proteins in same PDB: d2rhla2, d2rhlb2 automated match to d1rq2a1 complexed with gdp |
PDB Entry: 2rhl (more details), 2.45 Å
SCOPe Domain Sequences for d2rhlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhlb1 c.32.1.1 (B:12-208) Cell-division protein FtsZ {Bacillus subtilis [TaxId: 1423]} asikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglga ganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgv vtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlr qgvqgisdliatpglin
Timeline for d2rhlb1: