Lineage for d2rhla1 (2rhl A:12-208)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 protein domains)
  6. 2445159Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2445164Species Bacillus subtilis [TaxId:1423] [225542] (4 PDB entries)
  8. 2445169Domain d2rhla1: 2rhl A:12-208 [206125]
    Other proteins in same PDB: d2rhla2, d2rhla3, d2rhlb2, d2rhlb3
    automated match to d1rq2a1
    complexed with gdp

Details for d2rhla1

PDB Entry: 2rhl (more details), 2.45 Å

PDB Description: synthetic gene encoded bacillus subtilis ftsz ncs dimer with bound gdp
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2rhla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhla1 c.32.1.1 (A:12-208) Cell-division protein FtsZ {Bacillus subtilis [TaxId: 1423]}
asikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglga
ganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgv
vtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlr
qgvqgisdliatpglin

SCOPe Domain Coordinates for d2rhla1:

Click to download the PDB-style file with coordinates for d2rhla1.
(The format of our PDB-style files is described here.)

Timeline for d2rhla1: