| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein Cell-division protein FtsZ [52492] (9 species) |
| Species Bacillus subtilis [TaxId:1423] [225542] (4 PDB entries) |
| Domain d2rhla1: 2rhl A:12-208 [206125] Other proteins in same PDB: d2rhla2, d2rhla3, d2rhlb2, d2rhlb3 automated match to d1rq2a1 complexed with gdp |
PDB Entry: 2rhl (more details), 2.45 Å
SCOPe Domain Sequences for d2rhla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhla1 c.32.1.1 (A:12-208) Cell-division protein FtsZ {Bacillus subtilis [TaxId: 1423]}
asikvigvggggnnavnrmienevqgveyiavntdaqalnlskaevkmqigakltrglga
ganpevgkkaaeeskeqieealkgadmvfvtagmgggtgtgaapviaqiakdlgaltvgv
vtrpftfegrkrqlqaaggisamkeavdtlivipndrileivdkntpmleafreadnvlr
qgvqgisdliatpglin
Timeline for d2rhla1: