Lineage for d2rhja2 (2rhj A:209-315)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525408Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2525413Species Bacillus subtilis [TaxId:1423] [225543] (4 PDB entries)
  8. 2525414Domain d2rhja2: 2rhj A:209-315 [206124]
    Other proteins in same PDB: d2rhja1, d2rhja3
    automated match to d1rq2a2
    complexed with act, na, pg4, so4

Details for d2rhja2

PDB Entry: 2rhj (more details), 1.76 Å

PDB Description: synthetic gene encoded bacillus subtilis ftsz with two sulfate ions and sodium ion in the nucleotide pocket
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2rhja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rhja2 d.79.2.1 (A:209-315) Cell-division protein FtsZ {Bacillus subtilis [TaxId: 1423]}
ldfadvktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggt
nlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtviatgf

SCOPe Domain Coordinates for d2rhja2:

Click to download the PDB-style file with coordinates for d2rhja2.
(The format of our PDB-style files is described here.)

Timeline for d2rhja2: