Lineage for d2rhha2 (2rhh A:209-315)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) Protein Cell-division protein FtsZ [55309] (9 species) 
Species Bacillus subtilis [TaxId:1423] [225543] (4 PDB entries) 
Domain d2rhha2: 2rhh A:209-315 [206122]
Other proteins in same PDB: d2rhha1
automated match to d1rq2a2
complexed with so4
missing some secondary structures that made up less than one-third of the common domain
Details for d2rhha2
PDB Entry: 2rhh (more details), 2 Å
PDB Description: synthetic gene encoded bacillus subtilis ftsz with bound sulfate ion
PDB Compounds: (A:) cell division protein ftszSCOPe Domain Sequences for d2rhha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rhha2 d.79.2.1 (A:209-315) Cell-division protein FtsZ {Bacillus subtilis [TaxId: 1423]}
ldfadvktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggt
nlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtviatgf
SCOPe Domain Coordinates for d2rhha2:
Click to download the PDB-style file with coordinates for d2rhha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rhha2:
- d2rhha2 first appeared in SCOPe 2.03
- d2rhha2 appears in SCOPe 2.07
View in 3D
