SCOPe 2.03: Domain d2rgzb_: 2rgz B:

Lineage for d2rgzb_ (2rgz B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225276] (3 PDB entries)

8. Domain d2rgzb_: 2rgz B: [206120]
   automated match to d1wova1
   complexed with hem

Details for d2rgzb_

PDB Entry: 2rgz, 2.61 Å

PDB Description: ensemble refinement of the protein crystal structure of human heme oxygenase-2 c127a (ho-2) with bound heme

PDB Compounds: (B:) Heme oxygenase 2

SCOPe Domain Sequences for d2rgzb_:

Sequence; same for both SEQRES and ATOM records:

>d2rgzb_ a.132.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
madlsellkegtkeahdraentqfvkdflkgnikkelfklattalyftysaleeemernk
dhpafaplyfpmelhrkealtkdmeyffgenweeqvqapkaaqkyverihyigqnepell
vahaytrymgdlsggqvlkkvaqralklpstgegtqfylfenvdnaqqfkqlyrarmnal
dlnmktkeriveeankafeynmqifneldqagstlaret

Timeline for d2rgzb_:

• d2rgzb_ is new in SCOPe 2.03-stable
  
• d2rgzb_ appears in SCOPe 2.04
  
• d2rgzb_ appears in the current release, SCOPe 2.08