Lineage for d1nfda1 (1nfd A:1-117)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 52846Protein T-cell antigen receptor [48933] (6 species)
  7. 52873Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (11 PDB entries)
  8. 52885Domain d1nfda1: 1nfd A:1-117 [20612]
    Other proteins in same PDB: d1nfda2, d1nfdb2, d1nfdc2, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2

Details for d1nfda1

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfda1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
dsvtqteglvtvteglpvklnctyqttyltiaffwyvqylneapqvllksstdnkrtehq
gfhatlhkssssfhlqkssaqlsdsalyycalseggnykyvfgagtrlkviah

SCOP Domain Coordinates for d1nfda1:

Click to download the PDB-style file with coordinates for d1nfda1.
(The format of our PDB-style files is described here.)

Timeline for d1nfda1: