Lineage for d1kb5a_ (1kb5 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 364249Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 364286Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (16 PDB entries)
  8. 364302Domain d1kb5a_: 1kb5 A: [20611]
    Other proteins in same PDB: d1kb5h1, d1kb5h2, d1kb5l1, d1kb5l2

Details for d1kb5a_

PDB Entry: 1kb5 (more details), 2.5 Å

PDB Description: murine t-cell receptor variable domain/fab complex

SCOP Domain Sequences for d1kb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb5a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
qqvrqspqsltvwegetailncsyedstfnyfpwyqqfpgegpallisirsvsdkkedgr
ftiffnkrekklslhitdsqpgdsatyfcaaryqggralifgtgttvsvspgsad

SCOP Domain Coordinates for d1kb5a_:

Click to download the PDB-style file with coordinates for d1kb5a_.
(The format of our PDB-style files is described here.)

Timeline for d1kb5a_: