Lineage for d2rgva_ (2rgv A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260120Species Bacillus subtilis [TaxId:1423] [187193] (4 PDB entries)
  8. 1260130Domain d2rgva_: 2rgv A: [206105]
    automated match to d2o03a_
    complexed with zn

Details for d2rgva_

PDB Entry: 2rgv (more details), 2.05 Å

PDB Description: The crystal structure of PerR-Ox highlights 2-oxo-Histidine formation
PDB Compounds: (A:) Peroxide operon regulator

SCOPe Domain Sequences for d2rgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rgva_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
helkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynnl
rvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtgf
kvshhrleiygvcqecskken

SCOPe Domain Coordinates for d2rgva_:

Click to download the PDB-style file with coordinates for d2rgva_.
(The format of our PDB-style files is described here.)

Timeline for d2rgva_: