Lineage for d1fo0a_ (1fo0 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 220318Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 220353Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (14 PDB entries)
  8. 220364Domain d1fo0a_: 1fo0 A: [20610]
    Other proteins in same PDB: d1fo0h1, d1fo0h2, d1fo0l_

Details for d1fo0a_

PDB Entry: 1fo0 (more details), 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1fo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
kvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatvg
hyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp

SCOP Domain Coordinates for d1fo0a_:

Click to download the PDB-style file with coordinates for d1fo0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fo0a_: