Lineage for d2reoa_ (2reo A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2114345Domain d2reoa_: 2reo A: [206095]
    automated match to d1bo6a_
    complexed with a3p

Details for d2reoa_

PDB Entry: 2reo (more details), 2.65 Å

PDB Description: crystal structure of human sulfotransferase 1c3 (sult1c3) in complex with pap
PDB Compounds: (A:) Putative sulfotransferase 1C3

SCOPe Domain Sequences for d2reoa_:

Sequence, based on SEQRES records: (download)

>d2reoa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqakpddlilatypksgttwmheildmilndgdvekckraqtldrhaflelkfphkekpd
lefvlemsspqlikthlpshlippsiwkenckivyvarnpkdclvsyyhfhrmasfmpdp
qnleefyekfmsgkvvggswfdhvkgwwaakdmhrilylfyedikkdpkreiekilkfle
kdiseeilnkiiyhtsfdvmkqnpmtnyttlptsimdhsispfmrkgmpgdwknyftvaq
neefdkdyqkkmagstltfrtei

Sequence, based on observed residues (ATOM records): (download)

>d2reoa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqakpddlilatypksgttwmheildmilnqlikthlpshlippsiwkenckivyvarnp
kdclvsyyhfhrmasfmpdpqnleefyekfmsgkvvggswfdhvkgwwaakdmhrilylf
yedikkdpkreiekilkflekdiseeilnkiiyhtsfdvmkqnpmtnyttlptsimdhsi
spfmrkgmpgdwknyftvaqneefdkdyqkkmastltfrtei

SCOPe Domain Coordinates for d2reoa_:

Click to download the PDB-style file with coordinates for d2reoa_.
(The format of our PDB-style files is described here.)

Timeline for d2reoa_: