SCOPe 2.05: Domain d2rdwa_: 2rdw A:

Lineage for d2rdwa_ (2rdw A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189110] (5 PDB entries)

8. Domain d2rdwa_: 2rdw A: [206094]
   automated match to d2w0ua_
   complexed with fmn, so4

Details for d2rdwa_

PDB Entry: 2rdw, 1.95 Å

PDB Description: Crystal Structure of Human Glycolate Oxidase in Complex with Sulfate

PDB Compounds: (A:) hydroxyacid oxidase 1

SCOPe Domain Sequences for d2rdwa_:

Sequence; same for both SEQRES and ATOM records:

>d2rdwa_ c.1.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaetdls
tsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevaeagp
ealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppqlrm
knfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilrgdd
areavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdvlka
lalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlvrk

Timeline for d2rdwa_:

• d2rdwa_ first appeared in SCOPe 2.03
  
• d2rdwa_ appears in SCOPe 2.04
  
• d2rdwa_ appears in SCOPe 2.06
  
• d2rdwa_ appears in the current release, SCOPe 2.08