Lineage for d2rdta1 (2rdt A:1-363)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080511Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2080512Protein automated matches [190048] (21 species)
    not a true protein
  7. 2080558Species Human (Homo sapiens) [TaxId:9606] [189110] (5 PDB entries)
  8. 2080561Domain d2rdta1: 2rdt A:1-363 [206092]
    Other proteins in same PDB: d2rdta2
    automated match to d2w0ua_
    complexed with 2rd, fmn

Details for d2rdta1

PDB Entry: 2rdt (more details), 1.95 Å

PDB Description: Crystal Structure of Human Glycolate Oxidase (GO) in Complex with CDST
PDB Compounds: (A:) hydroxyacid oxidase 1

SCOPe Domain Sequences for d2rdta1:

Sequence, based on SEQRES records: (download)

>d2rdta1 c.1.4.0 (A:1-363) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlprlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaet
dlstsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevae
agpealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrfklppq
lrmknfetstlsfspeenfgddsglaayvakaidpsiswedikwlrrltslpivakgilr
gddareavkhglngilvsnhgarqldgvpatidvlpeiveavegkvevfldggvrkgtdv
lkalalgakavfvgrpivwglafqgekgvqdvleilkeefrlamalsgcqnvkvidktlv
rkn

Sequence, based on observed residues (ATOM records): (download)

>d2rdta1 c.1.4.0 (A:1-363) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlprlicindyeqhaksvlpksiydyyrsgandeetladniaafsrwklyprmlrnvaet
dlstsvlgqrvsmpicvgatamqrmahvdgelatvracqslgtgmmlsswatssieevae
agpealrwlqlyiykdrevtkklvrqaekmgykaifvtvdtpylgnrlddvrnrflaayv
akaidpsiswedikwlrrltslpivakgilrgddareavkhglngilvsnhgarqldgvp
atidvlpeiveavegkvevfldggvrkgtdvlkalalgakavfvgrpivwglafqgekgv
qdvleilkeefrlamalsgcqnvkvidktlvrkn

SCOPe Domain Coordinates for d2rdta1:

Click to download the PDB-style file with coordinates for d2rdta1.
(The format of our PDB-style files is described here.)

Timeline for d2rdta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rdta2