Lineage for d2rdaa_ (2rda A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428979Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1428980Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1428981Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1429014Protein Thymidylate synthase [55833] (7 species)
  7. 1429147Species Human (Homo sapiens) [TaxId:9606] [55840] (12 PDB entries)
  8. 1429163Domain d2rdaa_: 2rda A: [206086]
    automated match to d2aaza_
    complexed with bme, po4; mutant

Details for d2rdaa_

PDB Entry: 2rda (more details), 2.67 Å

PDB Description: human thymidylate synthase stabilized in active conformation by r163k mutation: asymmetry and reactivity of cys195
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d2rdaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rdaa_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
rpphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgv
leellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfga
eyrdmesdysgqgvdqlqkvidtiktnpddrriimcawnprdlplmalppchalcqfyvv
nselscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiep
lkiqlqreprpfpklrilrkvekiddfkaedfqiegynphpt

SCOPe Domain Coordinates for d2rdaa_:

Click to download the PDB-style file with coordinates for d2rdaa_.
(The format of our PDB-style files is described here.)

Timeline for d2rdaa_: