Lineage for d2rd8a_ (2rd8 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212113Protein Thymidylate synthase [55833] (7 species)
  7. 2212254Species Human (Homo sapiens) [TaxId:9606] [55840] (26 PDB entries)
  8. 2212271Domain d2rd8a_: 2rd8 A: [206084]
    automated match to d2aaza_
    complexed with bme, po4; mutant

Details for d2rd8a_

PDB Entry: 2rd8 (more details), 2.5 Å

PDB Description: human thymidylate synthase stabilized in active conformation by r163k mutation: asymmetry and reactivity of cys195
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d2rd8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rd8a_ d.117.1.1 (A:) Thymidylate synthase {Human (Homo sapiens) [TaxId: 9606]}
pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl
eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae
yrdmesdysgqgvdqlqkvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn
selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl
kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptik

SCOPe Domain Coordinates for d2rd8a_:

Click to download the PDB-style file with coordinates for d2rd8a_.
(The format of our PDB-style files is described here.)

Timeline for d2rd8a_: