Lineage for d1b88a_ (1b88 A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein T-cell antigen receptor [48933] (6 species) 
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (12 PDB entries) 
Domain d1b88a_: 1b88 A: [20608]
Details for d1b88a_
PDB Entry: 1b88 (more details), 2.5 Å
PDB Description: v-alpha 2.6 mouse t cell receptor (tcr) domain
SCOP Domain Sequences for d1b88a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b88a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
mqqvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsnkkedg
rftiffnkrekklslhiadsqpgdsatyfcaasasfgdnskliwglgtslvvnp
SCOP Domain Coordinates for d1b88a_:
Click to download the PDB-style file with coordinates for d1b88a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b88a_:
- d1b88a_ first appeared (with stable ids) in SCOP 1.55
- d1b88a_ appears in SCOP 1.57
- d1b88a_ appears in SCOP 1.61
- d1b88a_ appears in the current release, SCOPe 2.08
View in 3D
