Lineage for d2rcvh2 (2rcv H:93-201)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552893Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2552894Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2553188Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2553189Protein automated matches [226860] (37 species)
    not a true protein
  7. 2553234Species Bacillus subtilis [TaxId:1423] [225414] (1 PDB entry)
  8. 2553242Domain d2rcvh2: 2rcv H:93-201 [206073]
    Other proteins in same PDB: d2rcva1, d2rcvb1, d2rcvc1, d2rcvd1, d2rcve1, d2rcvf1, d2rcvg1, d2rcvh1
    automated match to d1dt0a2
    complexed with mn

Details for d2rcvh2

PDB Entry: 2rcv (more details), 1.6 Å

PDB Description: crystal structure of the bacillus subtilis superoxide dismutase
PDB Compounds: (H:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2rcvh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcvh2 d.44.1.0 (H:93-201) automated matches {Bacillus subtilis [TaxId: 1423]}
gggeptgalaeeinsvfgsfdkfkeqfaaaaagrfgsgwawlvvnngkleitstpnqdsp
lsegktpilgldvwehayylnyqnrrpdyisafwnvvnwdevarlyser

SCOPe Domain Coordinates for d2rcvh2:

Click to download the PDB-style file with coordinates for d2rcvh2.
(The format of our PDB-style files is described here.)

Timeline for d2rcvh2: