Lineage for d2rcvh2 (2rcv H:93-201)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) 
automatically mapped to Pfam PF02777
Family d.44.1.0: automated matches [227155] (1 protein)
not a true familyProtein automated matches [226860] (38 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [225414] (1 PDB entry) 
Domain d2rcvh2: 2rcv H:93-201 [206073]
Other proteins in same PDB: d2rcva1, d2rcvb1, d2rcvc1, d2rcvd1, d2rcve1, d2rcvf1, d2rcvg1, d2rcvh1
automated match to d1dt0a2
complexed with mn
Details for d2rcvh2
PDB Entry: 2rcv (more details), 1.6 Å
PDB Description: crystal structure of the bacillus subtilis superoxide dismutase
PDB Compounds: (H:) Superoxide dismutase [Mn]SCOPe Domain Sequences for d2rcvh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcvh2 d.44.1.0 (H:93-201) automated matches {Bacillus subtilis [TaxId: 1423]}
gggeptgalaeeinsvfgsfdkfkeqfaaaaagrfgsgwawlvvnngkleitstpnqdsp
lsegktpilgldvwehayylnyqnrrpdyisafwnvvnwdevarlyser
SCOPe Domain Coordinates for d2rcvh2:
Click to download the PDB-style file with coordinates for d2rcvh2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rcvh2:
- d2rcvh2 first appeared in SCOPe 2.03
- d2rcvh2 appears in SCOPe 2.07
View in 3D
