Lineage for d1ac6b_ (1ac6 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931485Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 931586Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (21 PDB entries)
  8. 931594Domain d1ac6b_: 1ac6 B: [20607]
    mutant

Details for d1ac6b_

PDB Entry: 1ac6 (more details), 2.3 Å

PDB Description: crystal structure of a variable domain mutant of a t-cell receptor alpha chain
PDB Compounds: (B:) T-cell receptor alpha

SCOPe Domain Sequences for d1ac6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ac6b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
dsvtqtegqvalseedfltihcnysasgypalfwyvqypgegpqflfrasrdkekgssrg
featynkeatsfhlqkasvqesdsavyycalsggnnkltfgagtkltikp

SCOPe Domain Coordinates for d1ac6b_:

Click to download the PDB-style file with coordinates for d1ac6b_.
(The format of our PDB-style files is described here.)

Timeline for d1ac6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ac6a_