SCOPe 2.07: Domain d2rcvd2: 2rcv D:93-201

Lineage for d2rcvd2 (2rcv D:93-201)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225414] (1 PDB entry)

8. Domain d2rcvd2: 2rcv D:93-201 [206065]
   Other proteins in same PDB: d2rcva1, d2rcvb1, d2rcvc1, d2rcvd1, d2rcve1, d2rcvf1, d2rcvg1, d2rcvh1
   automated match to d1dt0a2
   complexed with mn

Details for d2rcvd2

PDB Entry: 2rcv, 1.6 Å

PDB Description: crystal structure of the bacillus subtilis superoxide dismutase

PDB Compounds: (D:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2rcvd2:

Sequence; same for both SEQRES and ATOM records:

>d2rcvd2 d.44.1.0 (D:93-201) automated matches {Bacillus subtilis [TaxId: 1423]}
gggeptgalaeeinsvfgsfdkfkeqfaaaaagrfgsgwawlvvnngkleitstpnqdsp
lsegktpilgldvwehayylnyqnrrpdyisafwnvvnwdevarlyser

Timeline for d2rcvd2:

• d2rcvd2 first appeared in SCOPe 2.03
  
• d2rcvd2 appears in SCOPe 2.06
  
• d2rcvd2 appears in the current release, SCOPe 2.08