Lineage for d2rcvd1 (2rcv D:2-92)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1476004Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1476277Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1476544Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1476545Protein automated matches [226859] (26 species)
    not a true protein
  7. 1476562Species Bacillus subtilis [TaxId:1423] [225413] (1 PDB entry)
  8. 1476566Domain d2rcvd1: 2rcv D:2-92 [206064]
    Other proteins in same PDB: d2rcva2, d2rcvb2, d2rcvc2, d2rcvd2, d2rcve2, d2rcvf2, d2rcvg2, d2rcvh2
    automated match to d1dt0a1
    complexed with mn

Details for d2rcvd1

PDB Entry: 2rcv (more details), 1.6 Å

PDB Description: crystal structure of the bacillus subtilis superoxide dismutase
PDB Compounds: (D:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2rcvd1:

Sequence, based on SEQRES records: (download)

>d2rcvd1 a.2.11.0 (D:2-92) automated matches {Bacillus subtilis [TaxId: 1423]}
ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl
dsvpenirtavrnnggghanhklfwtllspn

Sequence, based on observed residues (ATOM records): (download)

>d2rcvd1 a.2.11.0 (D:2-92) automated matches {Bacillus subtilis [TaxId: 1423]}
ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegnanksveelvadldsv
penirtavrnnggghanhklfwtllspn

SCOPe Domain Coordinates for d2rcvd1:

Click to download the PDB-style file with coordinates for d2rcvd1.
(The format of our PDB-style files is described here.)

Timeline for d2rcvd1: