SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2rcvd1 (2rcv D:2-92)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979785Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1980056Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1980057Protein automated matches [226859] (31 species)
    not a true protein
  7. 1980089Species Bacillus subtilis [TaxId:1423] [225413] (1 PDB entry)
  8. 1980093Domain d2rcvd1: 2rcv D:2-92 [206064]
    Other proteins in same PDB: d2rcva2, d2rcvb2, d2rcvc2, d2rcvd2, d2rcve2, d2rcvf2, d2rcvg2, d2rcvh2
    automated match to d1dt0a1
    complexed with mn

Details for d2rcvd1

PDB Entry: 2rcv (more details), 1.6 Å

PDB Description: Crystal structure of the Bacillus subtilis superoxide dismutase
PDB Compounds: (D:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d2rcvd1:

Sequence, based on SEQRES records: (download)

>d2rcvd1 a.2.11.0 (D:2-92) automated matches {Bacillus subtilis [TaxId: 1423]}
ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl
dsvpenirtavrnnggghanhklfwtllspn

Sequence, based on observed residues (ATOM records): (download)

>d2rcvd1 a.2.11.0 (D:2-92) automated matches {Bacillus subtilis [TaxId: 1423]}
ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegnanksveelvadldsv
penirtavrnnggghanhklfwtllspn

SCOPe Domain Coordinates for d2rcvd1:

Click to download the PDB-style file with coordinates for d2rcvd1.
(The format of our PDB-style files is described here.)

Timeline for d2rcvd1: