![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (38 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [225414] (1 PDB entry) |
![]() | Domain d2rcvb2: 2rcv B:93-201 [206061] Other proteins in same PDB: d2rcva1, d2rcvb1, d2rcvc1, d2rcvd1, d2rcve1, d2rcvf1, d2rcvg1, d2rcvh1 automated match to d1dt0a2 complexed with mn |
PDB Entry: 2rcv (more details), 1.6 Å
SCOPe Domain Sequences for d2rcvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcvb2 d.44.1.0 (B:93-201) automated matches {Bacillus subtilis [TaxId: 1423]} gggeptgalaeeinsvfgsfdkfkeqfaaaaagrfgsgwawlvvnngkleitstpnqdsp lsegktpilgldvwehayylnyqnrrpdyisafwnvvnwdevarlyser
Timeline for d2rcvb2: